PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G107500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CO-like
Protein Properties Length: 425aa    MW: 46640.1 Da    PI: 5.2051
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G107500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.21e-0570112440
            zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40 
                         r+C+++     + +C+ ++ +lC+ C    H        H++v
  Potri.017G107500.1  70 RVCDTCRAAACTVYCRADSAYLCAGCDARVHAAnrvasrHERV 112
                         79******99******************999556677778766 PP

2zf-B_box28.14.3e-09112157342
            zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                          r+C+ +e+ ++ l C+ +   lC  C   +H+       H++vp+
  Potri.017G107500.1 112 VRVCEACERAPAALLCKADAASLCTACDADIHSAnplarrHQRVPI 157
                         689*****************************66899999**9997 PP

3CCT68.32.1e-23355398144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRY+eK+k RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Potri.017G107500.1 355 REARVLRYREKKKARKFEKTIRYASRKAYAETRPRIKGRFAKRT 398
                         9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003367.6E-867114IPR000315B-box-type zinc finger
PROSITE profilePS5011910.73667114IPR000315B-box-type zinc finger
CDDcd000218.30E-870114No hitNo description
PROSITE profilePS5011911.633110157IPR000315B-box-type zinc finger
PfamPF006433.5E-7112157IPR000315B-box-type zinc finger
CDDcd000211.08E-9113157No hitNo description
SMARTSM003363.8E-10115157IPR000315B-box-type zinc finger
PROSITE profilePS5101716.569355397IPR010402CCT domain
PfamPF062032.9E-17355397IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MPRVTSLILS SPLVFFLQVS LILATNAHSL SYIAKDSITE IGIGREREEV MLKEESGGSG  60
SGGVVNNWAR VCDTCRAAAC TVYCRADSAY LCAGCDARVH AANRVASRHE RVRVCEACER  120
APAALLCKAD AASLCTACDA DIHSANPLAR RHQRVPILPI SGYLYGTQVG PAAGETEDQF  180
MTQEGEETIG EEDEDEAASW LLLNPAKNSN NQNNNGFLFG GEVDEYLDIV EYNSCAENQY  240
SDQYNQQHYS VPPKSCGGDS VVPIQYGEGK DHQQQQQQQH HNFQLGLEYE PAKAAYSYDG  300
SVSQGVSMSS MDVGVVPESA MSEISISHQS APRGTIDLFS SPPIQMPSQL SPMEREARVL  360
RYREKKKARK FEKTIRYASR KAYAETRPRI KGRFAKRTDV DVEVDQMFSS TLMAETAYGI  420
VPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.128280.0bud| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5151500.0AY515150.1 Populus deltoides CONSTANS-like protein CO1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039781.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2-like
RefseqXP_011021143.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2-like
SwissprotQ965021e-150COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLQ6R3R20.0Q6R3R2_POPDE; CONSTANS-like protein CO1
STRINGPOPTR_0017s14410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-111CONSTANS-like 2